SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GE75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GE75
Domain Number 1 Region: 5-250
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.18e-52
Family Eukaryotic proteases 0.0017
Further Details:      
 
Domain Number 2 Region: 296-360
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000471
Family Tachycitin 0.0062
Further Details:      
 
Weak hits

Sequence:  E9GE75
Domain Number - Region: 254-306
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0418
Family ETX/MTX2 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9GE75
Sequence length 365
Comment (tr|E9GE75|E9GE75_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX82217.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_241413 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MRPIRRSTITSRIVGGSEAMANEFPWMAHLLIRGSDGQLFQCGGTLISDTHVLTTTRCVV
HNQTNKIYDLLKITLGANDITVGENSGQVLDWKKIVIPAGIELVEPDIAVITLSKPVTFT
DYVQPACLPFADDTDHVNDSVLLTGWGENSSGSVLRTIQTTVLSGGQCQQTARKVPALSA
NDVICTEQGSGQHCNADDGGPMNYYNAKLKRWFILGVAGRGDSGDCINSTIKPINVFTRV
GSRLDFIRDCSGVVSPITNANTTPTPEEFTTISYQETTEDGNINETTMETSTETTTNQPV
PFTCTGKTDGNYPNPASSCSANFYTCSPGNASLFACPSGLVYHAEIGVCDWPFNVAGCKK
PLLIF
Download sequence
Identical sequences E9GE75
jgi|Dappu1|241413|SNAP_00009471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]