SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GE98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9GE98
Domain Number - Region: 89-142
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000785
Family Pan module (APPLE domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9GE98
Sequence length 189
Comment (tr|E9GE98|E9GE98_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX82350.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_316885 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MSLCLLATAMIFIATSAEASPTVVVIPGNIDKRLTDPRCATCSDDCPPYCGPITTPHPVT
EPPCHDCHDTCPPYHKPPPKTKFPNLPSITYSTNCDFCEHDLYTLTCVATPFHCAARCAV
DLRCSHFTYIANLKGGTCVLKKAFGSGGAWASSIPSPSPYVCGYIPSRALIGIFLNICVG
LDITGSGRN
Download sequence
Identical sequences E9GE98
jgi|Dappu1|316885|NCBI_GNO_1800305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]