SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GEH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GEH1
Domain Number 1 Region: 26-263
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.76e-73
Family Eukaryotic proteases 0.00038
Further Details:      
 
Domain Number 2 Region: 269-330
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 1.39e-16
Family Tachycitin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9GEH1
Sequence length 331
Comment (tr|E9GEH1|E9GEH1_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX82265.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_223905 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MNVQLILTFGFVCGYFSLGNATPLDLPIKDPRIVGGTESVPGEFPWMAHLTIARMGMQRM
CGGSLISQNWIMTAAHCMDGAESVTVVLGGHNFNINNADIVTLQSKEFYIHPKYSSQTFP
DDVALIKLPVNVAFTARIRSVVLSDLGNRDHVNDTVIVSGWGYYSDAVESTSDVLLKAST
TVISNEMCSETWGSIIASTMICTSGTRGGICKGDSGGPMVYSVDGTWVQIGIASFGDNLC
ELMKPKGFTRIQSYLSWITSITGVSVATTQRPTTTPFSCQSDGIKSNPNDCNSFYMCSNG
TPYLFNCPGGLVFNPQLQQCDYRQNVPQCNY
Download sequence
Identical sequences E9GEH1
jgi|Dappu1|223905|estExt_fgenesh1_pg.C_180329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]