SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GEP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GEP9
Domain Number 1 Region: 282-517
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.42e-79
Family Eukaryotic proteases 0.00029
Further Details:      
 
Domain Number 2 Region: 838-984
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.68e-21
Family Eukaryotic proteases 0.0021
Further Details:      
 
Domain Number 3 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 47-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 599-640
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 6 Region: 1085-1120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 530-564
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 8 Region: 1178-1221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 9 Region: 724-766
Classification Level Classification E-value
Superfamily SRCR-like 0.0000641
Family Scavenger receptor cysteine-rich (SRCR) domain 0.07
Further Details:      
 
Weak hits

Sequence:  E9GEP9
Domain Number - Region: 1241-1287
Classification Level Classification E-value
Superfamily SRCR-like 0.000196
Family Scavenger receptor cysteine-rich (SRCR) domain 0.039
Further Details:      
 
Domain Number - Region: 25-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0288
Family LDL receptor-like module 0.0063
Further Details:      
 
Domain Number - Region: 647-669
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0314
Family LDL receptor-like module 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9GEP9
Sequence length 1308
Comment (tr|E9GEP9|E9GEP9_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX81874.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_317027 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MCDGKVQCPEATDETDCSCRSRMDPSKICDGIFDCPSLDDETSCRGCNATQFNCDITRAR
PLCIPLKQRCDGVEQCPDGMDEVGCSVLSPTQEPLEVSVAKYSSGYVMHNIKNKWYPLCD
SSHNVTQLVSGICQLTVGDSLGVFQVSKRKSNSSAYNGTFAMLTGIVNKPMVIGNCTDLL
FVQCPSPRCGRKAPSLAEIGRKVTIKPNITIASTTSKPNTFQNGNPSLLIKPFFGRSVQS
DQPSMDVEAPIRRFRKSDPTCQGSRCSRLTGRYPESLVQRRKRRGTLDRIVGGRESSMGA
WPWVVAIIRDGEFKCGGSLLDNSWILTAGHCFHMLEKSHFEIQLGMLRRSSFSPLEQTRA
VLSVYVHPKYNPLTLENDITLLRVQEPFQLNQWTAPACLPSLGYYPRNDTLCNVVGWGNV
QENGPESDSLREVAIPITPCKSDLQVDPKKVLCAGFPEGKKDSCQGDSGGPLVCPTNGRW
LLAGIVSFGLGCARPEELGAYTNVAYYTSWIKEIMDEKSDQPMRTPKPNCKGMICQRGTG
VCLSPNFICDGIVDCLNAEDEVNCGSAKLLSSTSHAPIISTEISTLAPILSTTPLPSTTP
TVCTADQFTCSKVFQCVPLSDKCDQIGDCKDGTDESSCSCADVLRNTGNSQLICDDHIDC
SDYSDEEGCRNCSAGEYYSFISSRCMPYKEMCDENLQSESHCAALIPQPFSVALDRMGKL
KREQSGIVAVNKLGRWQPFCAKNWTSSVNHEICSYLGYGPGLSYSFIPGMESAPIKNLEP
QQGFLWKTSKGINSQLVLPKSDAKIVDETSISSALHSIVKRQSTTTNDCKFVNVTCANQL
CGIRPNLGGWDNFPNRVGRFPWHVTLFLNGQYLCGASLVAPEWLLVSSNCVRNINLTKDY
VAALFGARRLIPFTSPMEQIRRVANTVKISTTSKMALLYLERPVELTETVNPICLVPMEN
VRALTKKNQCVAVSMNGTLLASSTGFSKINMTVRSLSVNWTDDENTTSCPSSKWSGSVTC
SDGLSWFAVAIFERDCSKRGPFVDTLEGIWQHFDAIESIIKCSSLKPKQRRKRQLQFSCP
MPILPAPSCNSWRCPLGTCLESDQVCDGVPDCRDRSDETKACRSPEVTTVTPFLNATKCA
RTEYECSNGKCIPGDMLCDGVVDCIAGEDEKGPFNDLECPTDFFRCLDPGQNRSQEMIPM
SAVCDGQRNCSNGMDERKCLSISAEFPVVTDKYGNPLKVSASGFLVLRLKGQWFPYCTNG
WTDKLTNDTCTGYGFGKSASFKAFNLSDASSLIRKSDQCSTVVYLTCA
Download sequence
Identical sequences E9GEP9
jgi|Dappu1|317027|NCBI_GNO_1900024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]