SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GG66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9GG66
Domain Number - Region: 70-115
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000147
Family Anti-platelet protein 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9GG66
Sequence length 142
Comment (tr|E9GG66|E9GG66_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX81344.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_303454 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MLIKLPSMPSIRLHFVSLRVRTMQNIGLTCICFVFAALSMSFRAVDGVPLGNKQWAEWNT
IGGGVKWLANCDFPGFDIRFEHIPVELCAKTCIDSSGCNAFSWNDGWCYLKNIPATSLRR
VPSPRGSCGFLPWEFSTSGFIS
Download sequence
Identical sequences E9GG66
jgi|Dappu1|303454|PASA_GEN_2100071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]