SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GGU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9GGU3
Domain Number - Region: 110-139
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0602
Family Antifungal peptide scarabaecin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9GGU3
Sequence length 241
Comment (tr|E9GGU3|E9GGU3_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX81301.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_242508 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MYPGSNLVTTCASWRKGSRIRRQLMLRSAENGRTIPSLDDMVNENSTKSIVLVNDAPSGK
DSRVADIDYFRMLGFVSLFSKSLCLAKLSIPPFPMSNVVENVLVAPQGQIPRCCNVAVRC
AEGNHEDSKCPSNDLWNKVKTLLTEHSIQKKECQTSLQEVMETSQWQVSLIHGFLEVLAS
EKKAEDHSTTNHYWTNLSTLRAACQFLQIPYSGQRGQEKREDFDIGENGVMMDTGHIGQI
I
Download sequence
Identical sequences E9GGU3
jgi|Dappu1|242508|SNAP_00010566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]