SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GHM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GHM4
Domain Number 1 Region: 22-79
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000392
Family Tachycitin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9GHM4
Sequence length 97
Comment (tr|E9GHM4|E9GHM4_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX81030.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_27118 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
VPGVPGVDYPVASRVPATLRFRCDQQDYPGFFADPETGCQVFHVCRDNKKTSFLCPNGTL
YHQRFFVCDWWFNVDCSKSVGLYPLNKDVIQRHEQQP
Download sequence
Identical sequences E9GHM4
jgi|Dappu1|27118|gw1.23.253.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]