SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GML1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GML1
Domain Number 1 Region: 296-441,549-643,745-847
Classification Level Classification E-value
Superfamily L domain-like 4.17e-54
Family Ngr ectodomain-like 0.0000236
Further Details:      
 
Domain Number 2 Region: 1110-1306
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-40
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 51-256
Classification Level Classification E-value
Superfamily L domain-like 7.29e-39
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 4 Region: 1044-1088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000023
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 5 Region: 962-1003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000707
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 6 Region: 885-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 1011-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000174
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 926-969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000297
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1351-1392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000165
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9GML1
Sequence length 1467
Comment (tr|E9GML1|E9GML1_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX79275.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_304927 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MRAFLFLWIFVLLLLHVAGGGQRDEPARSVAKGAGSDAAALPCSRLCQCEANAVDCSNRG
LTQVPLDLPKDADKINLEGNNLTSLLSSDFEGFANLRILRLSNNQLQYIPDLVFATLGHL
QRLDLSHNQLTAVGKRTLRGLNSLRNLQLDNNQLTCIDEAALRSQKELEILTLNNNNLTS
LPRDLFEPLSRLRVLRLSENKWLCDCHLAWLGRFLRRHARAGSPLAANGYLPRCHAPFGL
RIKAVSELLDTEFKCTGKTAERPSEECSAQPGCPLMCRCADGVVDCRDKSLSRIPPYLPD
SATELRLEQNQITEIPAKAFAAYKKLKRVDLSNNQISSIAGDAFHGLKSLTSLILYGNRI
TELPAGMFHGLTSLQLLLLNANRISCVRRDSFKDLHNLNLLSLYDNNIPTMLNGTFDSLR
NIQTLHLGRNPFLCDCYLTWLADYLHRKPVETSGVRCESPRRMQRRRISVLRDEKSRCSG
KSSPPFLSPPCEDDPSCPTECSCKGTIVDCSNKGLKEIPRELPLYTTELILNDNQIVRIK
ADGMFRDLPNLLKVDLRRNQISAIENGAFEGANTLVDLNLAENMIQEIHNKMFTGLVSLR
TLSLFQNKITCVTPGSFDYLRSLTSLNILSNPLHCNCHMAWFGDWLRKKEQELSTGAPRC
ASPARVKDIPLQDMPSFEFRCSELDDQGCLGEDYCPPKCTCTGTIVRCSRAKLREIPKNI
PPETTELYLDVNEIQSIQSERLSHLRSLTRLDLSNNMVSVLSNNTFVNLTKLSSLIVSYN
KLQCVQRNAFSGLLSLRILSLHGNDVSMIPEGAFTDLQSITHLALGSNPFYCDCNLRWLA
EWVKRDYVEPGIARCAEPILLRDKLLLTSPADHFQCKGKISNEVLAKCDTCYTFPCKNGA
TCRPTGERDYECLCAPGYHGKLCESAIDACYGNPCRNSAICKVLEEGRFSCHCSAGYEGD
RCETNINDCLDHKCVNNATCVDQVESYRCDCQSGYTGIYCEKKIQFCTKDFNPCKNGATC
VDRGDHYACQCALGFSGENCTVNNDDCISHMCQNGGTCVDGINEYTCKCPPEFSGKFCEA
SPMVSLLYPQTSPCQQHDCQNGICFQPQGLTDYICKCASGYTGKRCEFLTSVSFAQNGSY
IEMPSLKTKPEANITMIFSTEEENGILIYNGESQHIAVELFRGRIRVSYDVGNYPVSNMF
SYETVSDGRYHTVELLSQKKNFTLRVDQGNARSMINEGEHEYLRLSTPLFIGGLPNEAAE
KAARQWQLRNTTSFRGCIKELWINGKLTDYAQAATKQNRIIPGCANSESEETAAEMIKPK
ANNLKKDNAQREVKDSAAQPQSYMNTLKTSVLTSYDPCKDHRCRKGQCVSKKDGKNYSCK
CQAGWGGKYCDTAPTCRKEQYRDYYMEHGCRSTKPVRNSVCSGNCGSDCCRPRRSKKRRL
KLICNDGTRYTKEIEIVRKCGCSRKCL
Download sequence
Identical sequences E9GML1
jgi|Dappu1|304927|PASA_GEN_3100030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]