SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GNZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GNZ4
Domain Number 1 Region: 1011-1314
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.19e-47
Family Complement components 0.00013
Further Details:      
 
Domain Number 2 Region: 1403-1535
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.00000000000719
Family Alpha-macroglobulin receptor domain 0.0084
Further Details:      
 
Domain Number 3 Region: 695-732
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000275
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9GNZ4
Sequence length 1583
Comment (tr|E9GNZ4|E9GNZ4_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX78837.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_320143 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MCILMLNFFVTASSILRPDTLYRVHVVVLPGSPDLVFKALITKRSGQHVASASSDSVDAG
TSTHLLLKVPASISDGDYRLKLEGYDVQHPQQAVLIKESPLVFRSDFLSIIVQLNRKIFA
NAMTVRFRIILTQMDLKPYTDPITVFILDPQGFIVRRWPSRNPTNGVVSLTYQLPPNPSV
GSWTIRVEAMQQVHEHQFGVEHYYIPFFEVMPSAPAYVLDSDETYTVEVTTSVHTQFVAN
GNLTVHVYARPVNSTADDYQLVVEELFPWNHEFTYDVNLGDVKSAIRSRSLVGWVIRVKT
VLHSYFMGEARDGFIETRVIGAQLKFKFSGAKTAVFKPGMPYEGHVYVMYDDDQALSSEK
LAGATITLRPFVTSTNGQMKTLPEITVPAKGEYLSQKQDSNKMDHNNEFDNWMEHQIEDV
KFNQFRATGVYNFRFSVPKDAKSMRISATYKDGDGDKATAELQAVPFYSAKEMYAHVETS
TAYGQLGENVIIHLRSNFGFQVYSYVVVSKGLVIHGATETHPHPTKLVTFSVPVSSEMAP
TFKLVAMIVSPVGELVADSVTIPVQSFNRYKVNLTTVQVRDHSKETVQLVSRTRPGAYFG
YSLLRTLNYIFQADNELTPSRVLKALYKLEPFTKSVHRVTWTDREGLKAERTEYFKGANP
GADTKRTFDLAGLLIFSDARISQYPETTNCDQSNGYELCLAAGCFHKDRRCDGKADCTDG
SDEDDCKSFTFQSPREDDKMEFRLMRWSRNLDFYDWLDGDWAWFDVPTTDDGIEFQDQEV
AADDDSWYINAFSFHPEFGFAMLDEVVVYDGSPPFYVLAESPSAVHRGETLGVRLMAINN
LKEEVMTLIVLEASDDYLFVETGDDGEVEHYRPKLVGGEHHHMVAMKPESYREVYLPIAP
QVEQGSITVKIQIHTQIRRQIFELDLEIMPEGATISRHTSLLLDLKNRAHVLRFLDIPVE
ESPIIPYSKFRRYVYGSPRASITLCGDVFGPVFPSTPITTNSMLSRSLRGTEATLFNLAT
TLWSLHYLRLTNQLVSDVLYSGLNAMNVQMAELMRLYSHDGSFRAHTNSNPSVWVTAWVI
RVLGQSQFQDWENHFFVDRRLLGTSVQWILSHQANDGSFEDPDEYFFPLELRKASSNNST
RKGSLTAYVLIGLMKCRESLEGSLRVTTAIAELRAINYLERAISHLADPSEIAIVTYALS
IANSPTKEAAFYLLHNIKREGEGMVYWSREPVPSNKILYENQRPFLQPRLPMHQDAVAVE
ATSYALLVYLARDGIGDLQERVVSWLNTMRMVDGGFVSIYDSIVAMEALTEYAYRARLRD
ITDMSVVVEASASPDATELMKINSDTLATVHRMDIPNVWGHVNVIGRGAGQAVLQLKVQY
GIDWEELRDNPKRRYFDLYVEESYSHFRNKSHITVDACVKWMATDEMRTSGPATLEVEMP
SGYELIQSDANELVIRNNYTFIRDVFIGRGKIIWMFDRVGEERLCIKYPIHRWFPVANMT
LYRSAIIYESHMPEHFEMQVFNATPLYVLDICEVCGSYQCPYCPYFSGSPVSAKLSSPLL
VIFGSLLANAFVHYLHRHQFRPL
Download sequence
Identical sequences E9GNZ4
jgi|Dappu1|320143|NCBI_GNO_3300159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]