SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GNZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GNZ6
Domain Number 1 Region: 980-1284
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.34e-43
Family Complement components 0.00064
Further Details:      
 
Domain Number 2 Region: 1372-1504
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.0000000000222
Family Alpha-macroglobulin receptor domain 0.008
Further Details:      
 
Domain Number 3 Region: 671-704
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000641
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9GNZ6
Sequence length 1546
Comment (tr|E9GNZ6|E9GNZ6_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX78839.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_320145 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MFVLPDAEGLIVKALITKDGGQHIASAIETIDSGVSHNLLLKIPGSLTDGQYQLKLDGYD
LLQPQKSVFSKRGHLEFHPDFLSILVQTNRKIYKNEMKVRFRAIITQLVNLKPYSDPVTV
YILNPEGFVMRRWPSRYPTTGVITLLYQLPTFPSEGKWTIRVEAMSQIHDHHIIVERFYY
RFFDVIPSAPAYVLDSDESYTAAVTTSFHPGRVASGNLTLQVYARPVNSSLADFRFVRQD
FHQWTYDFTYNVQLEEVKRSVGVSSLTGWVIRVAMTLYHHFEGESRNGFIETRIIRAQLK
FRFGGSKTAVFKPGMPYEGHVYLMYDDDEAVSPEKLAGATLTIRPVATTSNGQLKTLPEI
VVPRQGEYHRSSDDDHLNYYGNKYDVWMDRQMEDAEYKTFRQFGIHHFRFTVPKDATSLK
ITAYYKDDEGDQVSVDQQAVAFYSLGNFFVHVSTSTDEGLLGHFATIHLRSNFAFQDYSY
VISSKGLVVHGATETLAHATKSLTFSVPVSTDMAPTFKLVAMMVSPLGDLVADSVTIPVQ
SINRYKTNLTMVQTKDHSKLTVQVVTRTLPGAFTGVSLIRSANYMFQADNEITYSRMIRA
LYQLEPFSRSVSGITWTDREGSKADKSQYFKSANPGADTKRTFNLAGLLVFTDARISQYP
DTANCNKANGYEPCMAVGCFHKDQRCDGKSDCTDGSDEDDCPLTKDDRMDFRMFRRNRFH
DFYDWLDGDWAWFDIPVTDDGFDFNDRSVALTNEVWFLNAFTFHRELGFAVVDDVVEYEG
SLPFYVSVESPSFIRRGETVGIRLLFINNLQVDTMGLIILEASDDYCFVETEAHGEVAHY
HPSLVCAEKHHVVTVKGGTTTEVFMPISPRIEQGSITVKIQVLSHIFEQNLEIGLEVLPE
GATISRHTSLLLDLKNRAHLLRFLDIPVEESPIIPYSKFRRYVFGSPRASITLCGDVFGP
VFPSTPITTDSMLSRSLRGTEANLYNLATTSWSLHYLRLTNQLVSDVLYSGLNDMNVQMA
ELMRLYHHDGSFRAHTNSNPSVWVTAWVIRILGQSQFQDWENHYYVDQQLLTNSVKWILQ
FQRRDGSFGETENYISPLDRRLLPRYNSTFKGGHTAHVLLSLCATSESLDGAVKVATASA
KVRAVRYLERILDILTDQYELAIVTYALQITSSPAQEAAFGRLHILRREEEGMVYWSREP
VPSNKILYENQRPFLQPRLPMHQDAVAVEATSYALLVYLARDGIGDLQERVVSWLNTMRM
VDGGFVSIYDSIVAMEALTEYAYRARLRDITDMSVVVEASASPDATELMKINSDTLATVH
RMDIPNVWGHVNVIGRGAGQAVLQLKVQYGIDWEDLRDTPKRRYFDLYVEETYSHFRNKS
HITVDACVKWLAMDEAPVSGSTTLEVELPSGYRIVQSDADQVLIHKNYTFLRDVFVSDEK
IVWTFDKVGPERLCFNYLIRRWFPVANGTMYRSAIVYESHSPEHFEMQVFNATPLYVLDI
CEVCGSYQCPYCPYFSAAPVVVSFNPIIVFCSLLISANICLNWSTS
Download sequence
Identical sequences E9GNZ6
jgi|Dappu1|320145|NCBI_GNO_3300161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]