SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GTI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GTI2
Domain Number 1 Region: 4-300
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.34e-46
Family NodB-like polysaccharide deacetylase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9GTI2
Sequence length 367
Comment (tr|E9GTI2|E9GTI2_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX77211.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_54528 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
PDEPAAKCNADVCRLPDCNCGGKDIPGGLRAIDTPQLVLLTFDDAVNDLNKELYSDLFET
GRVNPNGCPIAGTFYVSHEWTDYGQVQNLYADGHEIASHTISHSFGEQMSAKKWAKEAAG
QRDIMAAYGGVRAEDIRGLRAPFLSVGGNRMFKMLYDMNFTYDSSMPVYENKPPSWPYTL
DYKIFHDCMIPPCPTKSYPGVWEVPMVMWQDLNGGRCSMGDGCSNPPDAEGVYKMLIKNF
ERHYTTNRAPFPLYYHASWFTTAHHKEGFEAFLDTIVSMDDVWLVTNWQAIQWVRDPTPL
DRIKTFKPFNCDYPRCNASKVCNAWHKSGVRYMRTCQPCPEVFPWTGKTGVRNPFLDHYG
ENEVASA
Download sequence
Identical sequences E9GTI2
jgi|Dappu1|54528|e_gw1.42.38.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]