SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GTM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GTM2
Domain Number 1 Region: 66-123
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000118
Family Tachycitin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9GTM2
Sequence length 145
Comment (tr|E9GTM2|E9GTM2_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX77105.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_106356 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MITSSNAFSNYSNSQSGIPKVNIHRKMMRQVAVLLCVAFAVSLVYSLPALHRAKRWEEFP
NVTLTFDCTDRPLGFYADQEFECMLFHMCDEDGRRIPYMCGSGTAFNQQYRICDWIHNFD
CKEADKWFYLNELTYVTDPPKQIKA
Download sequence
Identical sequences E9GTM2
jgi|Dappu1|106356|fgenesh1_pg.C_scaffold_42000069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]