SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GV02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GV02
Domain Number 1 Region: 35-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 120-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 76-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 4-30
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000012
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9GV02
Sequence length 153
Comment (tr|E9GV02|E9GV02_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX76580.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_16163 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
FKCRTSCIPAKYRCDGVNDCALGEDELQCRNTTTEVGCTSSQFQCKNGGCISIHFYCDGD
ADCQDRSNEPDSCPPYVCKEEGEHSCPIQHHCIPRSAVCDGNEDCNDKSDEANCTSTHSV
CSSTQFHSFKSDICIPLSWVCDRDSDCQDGEDE
Download sequence
Identical sequences E9GV02
jgi|Dappu1|16163|gw1.1121.4.1 jgi|Dappu1|27153|gw1.45.86.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]