SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GW02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GW02
Domain Number 1 Region: 339-404
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000162
Family Tachycitin 0.04
Further Details:      
 
Domain Number 2 Region: 202-216,316-342
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000968
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9GW02
Sequence length 577
Comment (tr|E9GW02|E9GW02_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX76357.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_306237 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MCMLFPSTPVLGPVALATVQAQYYYPQPSPPFELPGPTPAPTTQAPTPAPTTAAPTPAPT
TPAPTPAPTTPPPPPPPVAPVVEEYTTPSPPPPTTAAPTTLPPPPPTTTAAPTPAPTTPY
VPPPPPPTTAAPPPPVEYLPPVATTTLPPPPPPTTTLPPPPPPTTTLPPPPPPTTTLPPT
TTVYVPPPTTTVYVPPPTTTLPPPPPPTTTLPPPPPPTTTTAYTQPPLEYLPPVTSRPVP
VPTENPLFPDANENQQVSILFPTAAPATTTTTAAPAPTTAAPAPTTTAAPVVVVTTPRPA
PPPVAPVLTEEEEEILFWDFRESIPGEPELDYPIFDKIPVTTFTCDDKIDGYYADVEARC
QVFHVCTAVPNEKSVKNSFLCPNGTIFNQENFACQWWPDVECATSSSFFSLNENIGKVPE
RSPEQQQVVIAAAAPAVVVAAAPEPAKIAEPAVLAIQLPAVIPVIQAQAAAVSESFAAPV
AVEAAAAVEVPAAVEIQQEQIAFVAPAAEIAYESAAAASPEVQAVIIPELPAEIPAPVIL
SIRDEPTQEAIQITLPQAPSGLYEAPDASSSVAQQKY
Download sequence
Identical sequences E9GW02
jgi|Dappu1|306237|PASA_GEN_4700044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]