SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GX43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GX43
Domain Number 1 Region: 66-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000123
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 2 Region: 10-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000171
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9GX43
Sequence length 116
Comment (tr|E9GX43|E9GX43_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX75928.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_34358 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
CQGGQYTLLVDSYTCSCPQCFDLTSDGKQCLDHDECVETGMCTHGICITWTCATRSSSSA
PSATPVDGKTCTDINECDLNPGICKGGGLCVNTDGSFKCTCHPVLRLYKTATRCID
Download sequence
Identical sequences E9GX43
jgi|Dappu1|34358|gw1.50.73.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]