SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GYE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GYE4
Domain Number 1 Region: 377-488
Classification Level Classification E-value
Superfamily C-type lectin-like 4.47e-46
Family Noncollagenous (NC1) domain of collagen IV 0.00000688
Further Details:      
 
Domain Number 2 Region: 264-374
Classification Level Classification E-value
Superfamily C-type lectin-like 1.7e-45
Family Noncollagenous (NC1) domain of collagen IV 0.00000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9GYE4
Sequence length 518
Comment (tr|E9GYE4|E9GYE4_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX75371.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_306783 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MPGIPGPNPMKGEPGMPGVPGRPGLYGRSGQKGAPGNYGPNGPVGIEGLPGISFKGQRGL
QGAKGLPGTPGRDGQTGLLGTDGLTGRQGYKGERGSQGSVGIRIKGQSGDSGFDGLPGLS
GSKGMQGDAGRNGQIGQPGPNGLRGVDGDVGFVGLQGFPGSKGMMGDNGPPGFPSDKGQR
GDVGPPGLPGMSGARGQIGLPGLQGLKGMAGDIGMQGFPGLPGLRGPVGFRGDDGLEGAV
GLAGQKGPKGLVGEPAPPPPPPKSRGFFYTRHSQSSRIPGCPAGSQELWTGYSLLHLTGD
SKAHGQDLGAPGSCMPRFSTMPFLFCNLDNVCNYASRNDYSYWLSTPEPMPMMMTPITGN
ELTRYVSRCSVCETPTHVIAVHSQSMEIPDCPAGWQELWIGYSFLMHTDSGAEGSGQSLV
SPGSCLEDFRPTPFIECQGHGRCNYYATATSYWLSTIEEDRQFAKPLPQTLKAGDLTSRI
SRCAVCQRKFAQPNSSRAPPSNFSSSRSVRSGRRTSSF
Download sequence
Identical sequences E9GYE4
jgi|Dappu1|306783|PASA_GEN_5300053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]