SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GZB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9GZB7
Domain Number - Region: 5-57
Classification Level Classification E-value
Superfamily HMG-box 0.000119
Family HMG-box 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9GZB7
Sequence length 230
Comment (tr|E9GZB7|E9GZB7_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX75188.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_323625 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MSLSKYTAFGTFYKCRCEDFKLADEGCRVMDYNFASIAETWKALSKEEQQPFYDVTAMTN
ALLDEEKKAIDKEIMSLRPESAKIVVIPSPAGFYKRTSTSSTNVPLIRFFDRASARNRLN
RGKSAQYQCQKHRQEARNKSKRRRWVGNYRAFVAESHSDWPTLSPAQQRHFIHQAKVEYH
NYNHRSSVGDGVVYAVLARSLAKHSEAASRPRLNNEYLSDDEDEEVNGNK
Download sequence
Identical sequences E9GZB7
jgi|Dappu1|323625|NCBI_GNO_5500043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]