SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9H0X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9H0X2
Domain Number 1 Region: 40-287,363-414
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.95e-91
Family Type II chitinase 0.00000368
Further Details:      
 
Domain Number 2 Region: 287-362
Classification Level Classification E-value
Superfamily Chitinase insertion domain 7.79e-16
Family Chitinase insertion domain 0.00051
Further Details:      
 
Domain Number 3 Region: 472-519
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000314
Family Tachycitin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9H0X2
Sequence length 526
Comment (tr|E9H0X2|E9H0X2_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX74629.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_307182 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MWQTLFIVTALILQVTLAAQPRESDENEIKANALPDRLAKRVCYFSNWAVYRPGKGSYDI
DDIPGEMCTHIIYSFCGVSNVTWGVLVLDQERDIDNGGYAKFVALKNKYPNLKPMLAVGG
WGEGGKKYSQMASVPARRQSFVSSVVEYMNQYGFDGFDLDWEYPGAADRGGTYADKETFL
ALVRELRAAFDAVGKGWELTAAVPVAKFRLQEGYHVPELCQLLDAIHVMTYDLRGNWVGF
ADVHSQLYRRPGLDQYAYEKLNVNDGLLLWEEFGCPRDKLVVGTPFYGRTYTLGDPKSTD
LGAYIVKWAGGGEPGPFTNASGFMAHYEICVKHLDPADGWVKRYDDVGKVPFTHKDRQWI
GYEDEDSLKIKMDFIRARGYGGAMTWAIDMDDFHNLCGKGHHSMMKVLYDGMKDYIVPVP
PPMTTTTAVTWWKPWRPDPTKSLDSVPSTTQKPKGAVKLEETVQSVDVAGLDCNKQSYWP
HEKCAKYYWCVQGSPRLLECPGGSVWNRVGNFCDWAKNTDTSTCTL
Download sequence
Identical sequences E9H0X2
jgi|Dappu1|307182|PASA_GEN_6000017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]