SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9H1J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9H1J1
Domain Number 1 Region: 64-123
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 1.96e-17
Family Tachycitin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9H1J1
Sequence length 126
Comment (tr|E9H1J1|E9H1J1_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX74496.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_324314 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MTEQSSTESTLTTQKPTTESTLTTPNSTTTATTVTTVVTQKPTTESTFTTPKSTTTATTV
TSTGTTPFACPGTNGVFPNPTNCKTFYMCSNGIPYLYDCPSNLVFNAATGNCDYEVNVAG
PCGSAR
Download sequence
Identical sequences E9H1J1
jgi|Dappu1|324314|NCBI_GNO_6100041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]