SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9H1L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9H1L9
Domain Number 1 Region: 122-183
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000837
Family Antifungal peptide scarabaecin 0.074
Further Details:      
 
Domain Number 2 Region: 48-115
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000889
Family Tachycitin 0.017
Further Details:      
 
Domain Number 3 Region: 301-357
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000068
Family Tachycitin 0.038
Further Details:      
 
Domain Number 4 Region: 191-254
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000811
Family Tachycitin 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9H1L9
Sequence length 374
Comment (tr|E9H1L9|E9H1L9_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX74481.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_108870 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MTKTLLVVVALVCLYGCVWDVASAMPQDSFKSAWLADPTLNHVPDTRNAALCTGQPDGFY
SIPDTCASAYYACIEELYYPQTCPGGGTFDPVLLKCVAPSTASCLTTTTTTTTTTTTVKP
FSCPTDGFYPVGPCSSSYYICIGGDVYPQMCPPNGVFEPSTSTCVSVDTAPCKATTTTTT
TTTTTTTTLAPFTCPADGFFEISPCIQTYYVCSGGQEYPQTCPGNAIFVGPPTSACKRPE
DTTCFLTTEPPTEPPTEPPTEPPTEPPTEPPTEPPTEPPTEPLTEPPTTAPPPVDGADCS
CPTADPCYIPISPTVCVGEYYTCFNGQLSAMSCPPPNVFDPKIGGCTGPSFASCNQPARS
WYRTAIRKIRSVLF
Download sequence
Identical sequences E9H1L9
jgi|Dappu1|108870|fgenesh1_pg.C_scaffold_61000081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]