SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9H1M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9H1M3
Domain Number 1 Region: 192-252
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000167
Family Tachycitin 0.012
Further Details:      
 
Domain Number 2 Region: 31-103
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000523
Family Tachycitin 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9H1M3
Sequence length 280
Comment (tr|E9H1M3|E9H1M3_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX74477.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_307288 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MAKEIVAPLLVLLFSFLCFGQCFERSPLKTLQDRADFVCPPGEEGFFFVEPCTQFYYYCT
AAGGQYLIECPAGTVFDPFQPTGPSCVSPEDAVCEDPAATTTEPTDTTTTTTDSTTTAST
TTTTTTELTTEITTEPPTSTTEPTTITTESTTKTSDEPTTTETTKTTVTVTPTPSISTTT
RTPNTCGNSSTTNSFTCPDGGSGEYPYDDCSSLYWQCSNGMAYLTCCPANLVYNPALNVC
DYYYNVDGCNPIKNDTGNQNQPENKNKMELRQRNLSPKRT
Download sequence
Identical sequences E9H1M3
jgi|Dappu1|307288|PASA_GEN_6100057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]