SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9HD55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9HD55
Domain Number 1 Region: 95-157
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000549
Family Tachycitin 0.03
Further Details:      
 
Domain Number 2 Region: 39-93
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000011
Family Tachycitin 0.014
Further Details:      
 
Domain Number 3 Region: 171-233
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000654
Family Tachycitin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9HD55
Sequence length 234
Comment (tr|E9HD55|E9HD55_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX70307.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_328176 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MKCPSTLATVATLVLFQVCLGQLASAGLLHDRLLAKEDFVCPSDGFHAVPGTCSGSYYSC
VNGFPYLMTCPGSAVFDPALSACVPPGDASCNQAFQCPAQGGFYAIPGTCGGNYYSCING
VAYVLTCPGSSIFDPAVGVCVPKEVASCLDETTTPTVSTVSPTPTPVSTTTTTQSPGTFT
CPSEFGFFPTGIPCDDDFWRCSNGLSYLMSCPPTTIWYQDQTICDYPYNVPGCA
Download sequence
Identical sequences E9HD55
jgi|Dappu1|328176|NCBI_GNO_10000065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]