SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9HF29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9HF29
Domain Number 1 Region: 39-101
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000785
Family Tachycitin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9HF29
Sequence length 117
Comment (tr|E9HF29|E9HF29_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX69619.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_62084 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MINHLYTLKTLGEFRRQPSRIGRKLLGVAGEDYPMFPVVPSTAFKCNPNKPGYYADVEAL
CQVFHVCQIDGRHDSFLCPNGTLFNQNYFVCDWWYNVDCSAAPSLYIRNEMLFQHPQ
Download sequence
Identical sequences E9HF29
jgi|Dappu1|62084|e_gw1.111.34.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]