SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9HFR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9HFR8
Domain Number 1 Region: 94-389
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.78e-27
Family NodB-like polysaccharide deacetylase 0.034
Further Details:      
 
Domain Number 2 Region: 23-85
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000186
Family Tachycitin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9HFR8
Sequence length 469
Comment (tr|E9HFR8|E9HFR8_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX69367.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_300968 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MALTKEKEIGDCEMKRKRRQSEDYVCPVGSGNFADPKSCRRFYQCVEGTPFLSRCPSSLF
FDDIQKLCTFKNEAVCGPVATTPAPVVVDEVDKALKCDSAKCQLPNCFCSRDGTLIPGGL
NPKEIPQMVLISMSDTVNANNYGDFHKVFEGRTNPNGCPVLGTFFVAHEFTNYQNVQQLH
YEGHEIATYSIRKNFDDLSYEEWVQEQIGMREILQNFANVSKLDVFGMRSPHLKPGWNTQ
YEVLVDYGYVWDSSAAVPPLKVPVWPYTLDYAIPHECRSGTCPTRSFPGIWEFPLNSHYV
NSFDGGYCPFMDQCVLHNMDENDVLAWLKEDFARYYDGNRAPYLMAFHTSWFQQKSLVRG
LQLFMDYLTQTPDVWFVTHTQALFWITEPKTIKEMSSVYQPWECKERVVPPQPCNLPSSC
PLSFKGANVTETRYMATCFSCPKVYPWLGDARGAGLSVKDVYKSENPSL
Download sequence
Identical sequences E9HFR8
jgi|Dappu1|300968|PASA_GEN_11500045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]