SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9HI04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9HI04
Domain Number 1 Region: 32-321
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.11e-27
Family NodB-like polysaccharide deacetylase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9HI04
Sequence length 377
Comment (tr|E9HI04|E9HI04_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX68640.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_228902 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MQRILVVIFFLAVFLHQSQAQCTTANCVEPACKCMNPSPPGGLSLANTPQLVFLAFDGAI
TTTNYNNYTFLLNNRINPNGCPIGMTFFIFHEYNDYSLTHSLYFKEQEISTHSMSHLTPA
ANWANKSVAEWTDEIGGIQEALAEFANIPVAGIRGARAPFLQSSGDATFTAMKNLGMFYD
CSFPETSVNRTNPPIWPYTLDQGFQHECAIPPCPKNKYPGIWTVPMVALNRNDTVCSMAD
ACDKPNTLDETYQYLLDNFQRHYTTSKAPFGIYLTANAWFQEADYRLQGYKKFLDTLSTK
DDVYIVPIARGLDWMKNPKPLAEVGNFFSCPPLTQTSCGNYTCSYEGDASPVGPRNMKSC
VTCPDVYPWTGNPLGLP
Download sequence
Identical sequences E9HI04
jgi|Dappu1|228902|estExt_fgenesh1_pg.C_1290063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]