SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9HJI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9HJI6
Domain Number - Region: 250-291
Classification Level Classification E-value
Superfamily HMG-box 0.00523
Family HMG-box 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9HJI6
Sequence length 1319
Comment (tr|E9HJI6|E9HJI6_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX68099.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_229018 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MSENRAILEKTFALTSQQQEGTIALLDVTVEGQILVEGNLTELEEAPNVVGSSAQTEEEA
EIPIAYVRQEIVDLGESNDEEDEDEEADSDATEENPHLAAEDHPSEDSQDRAWPDSPPPP
PPPYSPEATSSRRRRSPLDQRGKLRSPSPPGYVPSYYLQNMEEKKAEKNQIPLGGLDGVL
EKPSGLEGKNVMAAKTLISPALAASGQQSVMVYHRIIFVTRSAAAYYGMTHPSRLGERTP
DQMDYFCSKFSVETRKRWIEEHSKIYEDYVVEMDEFRRSLSPAERTSFRAFRNNRAGVLE
DGDTNSKSTSASLKSLEDFLKTKLFYEKKKLNLLQEGYAKLTAELNQGIDDTVTPLCIEQ
HGVIHLEDIYCWLTPKDSEIDESAAKELADAKEYARRMNAVPKEDDKIKELIEERAPYNQ
KFELCEALLSVGAWDQASILLEFHPDFFVTSYLPISSSICNLVDNVIELVYRTRCCTSPE
PSDKPVLPVGVCNPPKTAKEMKELRETAFPMLLSLGPHLYNYPVLPHKLIGLCNTALDDC
GLNSSKELPKDLDSLYINVRTLFDVVILPSLALLESNSSVAEEIWNVLKKLPCEHRHQLQ
SIEASEEMTKEHMEAMQGGELLRAEVAHFGQVRVTKKVAQRLKETLLESNLAIPLCDLIA
QQRGKSRQCPENRELDGKLYDQCQVTLVQLGTFSALNMSDDDHVRCRPQLESWLSDCHNH
ADVAFFLARPMFAHAINSKYDELRRAEKNLLPDQNTQKYLESVRLVMTPISRSVRPLFAA
QVWEHLSPQFFATFWSLTVYDLSVPNAAYEREVQRLEEAIQQKDENRDLPDSKRKKELDR
CTALMDKLLAEEKKQKDHNERIMARLAQEKDSWFLKSSQMETIIQFLRHTAFFLAAFSSR
QMPYFALALCRYVRLMHNLKTPNFSTLNCYDCIFLDITKTVTSCTENEANCYGRFLCAML
ETEMHWHSSKKIFDEECANYPGFVIKFCVGEQPPEKNDHVDFENYRHAVHKWHYKIAKAL
VVCLESKDYVQIRNALIVLIRILPFFPVITPLVGFIDRNVEVVRSEQRDKRQDLSEMAIS
YSGQLKNKKTSIPEHEFHLVTRKPVTKTAPRDREDHKERRFIKPRRNLVKGKASVKGELD
VSFCSKVTDVGLASLCVSVDHLGNKNEFLCLCKSIVKQWTNRTQVTNSGIQVAIENLPEL
EYCDMASIQISAEMHQRDFRSKEQLEIPKYSFVDLKLKKKYSSPYTCGSLKMVLSLCPSL
LKVHITTIAGLRNADLLSLISVERLCEQNTGVCGYFFELTTPRVPWCTRNQEINQTSST
Download sequence
Identical sequences E9HJI6
jgi|Dappu1|229018|estExt_fgenesh1_pg.C_1400028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]