SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9HR71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9HR71
Domain Number 1 Region: 259-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000324
Family EGF-type module 0.026
Further Details:      
 
Domain Number 2 Region: 228-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000436
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  E9HR71
Domain Number - Region: 162-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000524
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 196-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000935
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 302-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00277
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9HR71
Sequence length 335
Comment (tr|E9HR71|E9HR71_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX65761.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_116992 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MERRNRQQQQDKDDLSLWIDQQQVKMFSGFPMEIYIAAEGRVLSYILDPNFEKYLPVIPS
EVGYVNFTWKSGEHKKYYYHFDRLQSFNEDILQPPTVSVEIRGRVPRKPKVFSVLLPCSG
NSSGVASFSIGLLIESHKGKPLPGTPLRLRLRKECAERGPDPECDKKCANGGWCNHEKIC
QCLEGYMGQHCRTALCYPQCMNGGSCTSPGMCSCPSGFQGRHCEGGICKDKCLNGGKCIQ
KDTCDCPKGFYGLRCEFTKCVIPCLNGGRCKGVNKCRCSPGFKGDHCEVTPPGRLAQRHL
CQRPCRHGTCVGQNRCLCHEGWHGKLCHRSMTNEC
Download sequence
Identical sequences E9HR71
jgi|Dappu1|116992|fgenesh1_pg.C_scaffold_211000008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]