SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9HRW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9HRW2
Domain Number 1 Region: 38-91
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000366
Family Tachycitin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9HRW2
Sequence length 116
Comment (tr|E9HRW2|E9HRW2_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX65516.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_333109 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MFITKALLLIAFVPFLTSALEDGFICPKLLSSEFVKDPNPKYPHPTNCQKYYVCLKGVTP
VEQSCYPGEVFNNNSKQCDLPENVTECIDWYKDHPADDIDEVVAPKFNFKGKYGRK
Download sequence
Identical sequences E9HRW2
jgi|Dappu1|333109|NCBI_GNO_22000019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]