SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9HVM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9HVM5
Domain Number 1 Region: 360-526
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-16
Family YWTD domain 0.001
Further Details:      
 
Domain Number 2 Region: 47-154
Classification Level Classification E-value
Superfamily TNF-like 0.0000000000167
Family TNF-like 0.0061
Further Details:      
 
Domain Number 3 Region: 297-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000379
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 4 Region: 195-231
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 266-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000013
Family EGF-type module 0.059
Further Details:      
 
Domain Number 6 Region: 594-632
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000956
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9HVM5
Sequence length 660
Comment (tr|E9HVM5|E9HVM5_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX64194.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_305193 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MEIIEKDLNMKEAMLLALNGREILLGNKIKHDLNFYNDPSVLDSWNISFFAQRTGTFHVK
TVIHPYDIVPLNQGQCFSSSSGVFTVPFHGIYHFYFTALKMKKQESGTGRLTIQLVKNRK
IVPIFREVLAEIHMDSADSYVFFPLQLQATAELQERDEITGELFEVNDLKLSRHVSTGDC
ITANGSDCHYKLGSSCSEGDFRCDNGHCIPMDPVCDEVMDCPDGTDEGDNCGNMFKLSIR
FLVPTHSWSLLIHGLLNPFIDTPCEENFCEHNCVPGPKGPICYCEAGYRSENNGPQCVDI
DECLSENRCSQYCANTEGDYDCSCAPGYYLEPDKYTCKVMDKRPLLIATSAHRVALLRNN
NVTASHRDSITGNVYVSALVANQDRSVVKVVSHSLDADVDIDNSQAKITDIIIDGVRGAL
FWSEHLRSASGRIFRSTMDGKVTREIYYSGAAYPVALALNMVKTRIYWADKGQSISSCDY
NGQQKKKLVVGRTNGLPLSLTFFENRISWTVWRRNVVYSQSVTGEPATSSLTALEDVHHL
FTSHSILEPEYPNPYKSSSCGNGLCVLRNSSSFSCFCPTKTNVVSIAPFECSSRCPSHSF
YCQPESECLPLSLVCSDHQDCDKLSDQDLCKSANKTISSEDIFRQTFLPGEDCNIFLNSP
Download sequence
Identical sequences E9HVM5
jgi|Dappu1|305193|PASA_GEN_35000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]