SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9HZ18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9HZ18
Domain Number 1 Region: 102-227
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000183
Family YWTD domain 0.0048
Further Details:      
 
Domain Number 2 Region: 651-698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000547
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 3 Region: 579-614
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 340-376
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 623-664
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family EGF-type module 0.068
Further Details:      
 
Domain Number 6 Region: 381-420
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000602
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 7 Region: 2-76
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 0.0000769
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.016
Further Details:      
 
Weak hits

Sequence:  E9HZ18
Domain Number - Region: 423-462
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000123
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number - Region: 300-335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00183
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number - Region: 267-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00399
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 542-563
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0072
Family LDL receptor-like module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9HZ18
Sequence length 739
Comment (tr|E9HZ18|E9HZ18_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX63012.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_269232 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MYKLYGYKFFSSATDADTALTLARVVDPATDKITSGSKGFLLFLVYMDQPSNLHLMRLKQ
KLGTKLDALGYLSADDPIRKRRHGRGIGLTRGTVVIGQKNHDGVYERLVLARYLYSPQGI
TIGSQSGRMFIVEGRISHVISVWHMDGTNRQELVQVYGTVSAMTCDGKHFYFSDSLRGTI
ERIEVNGENRTILRFHLGTPVAMDASSDSVFWLTQSSTRISWLNKQETKTMRGFVIDASD
DINVQYRLMSVIDLFDFNSHDHHFFHHTGGCSDICAPTPDGPDGVACLCPLGKVLGEDKH
VCTKADCVASCIPAKFRCDGVNDCARLGEDELQCRNTTTEVGCTSSQFQCINGGCVSIHY
NCDGDADCRDRSDEPDSCPPYVCKGEGEYSCPNPHHCIPRSAVCDGQADCIDKLNEANCS
STHSMCSSTQFYCSHSHIYIPLTWVRDRDSDWQHGEDEDSSVCDSVVNKPPCPINYLRCP
QRPDCMPRIECEHGTDADLCAKLNDSFIETETEKPDCLSSQYNCFLGSNECIPITSRCDC
RIYISWVCDGLSDCSNSADEALLLCPANVSTSSSSTTKITRSCSATDFMCLSGECVQASS
VCDGKFDCFDGTDEGSGCAKACQNNGQCPQICVPGPMEPTCLCEPGYESLNNGKQCVDID
ECAFEFNKCSQFCNNTKGGYRCSCASGYSLEPDQITCKAASGRPMLIVATNHPVEILLNS
DITSSRFLVQSVPAIKGIA
Download sequence
Identical sequences E9HZ18
jgi|Dappu1|269232|SNAP_00037290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]