SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9I1L2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9I1L2
Domain Number 1 Region: 7-72
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000068
Family Tachycitin 0.017
Further Details:      
 
Domain Number 2 Region: 76-122
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000123
Family Tachycitin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9I1L2
Sequence length 184
Comment (tr|E9I1L2|E9I1L2_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX62118.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_230004 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
SAQNIRSDTFVCPKENGFFAHDISCDKYWKCVEGVATLELCGNGLAFDDTDLKNQRENCD
YIYNVECGDRLEVEAPISTRNCPSLHGVFPDETKCDVFWSCWNGEASRYQCAPGLAYSRE
SRVADYYGTLDLDGLRNTEVQAGLAPEAAPVKVAPKKPVTSRPAFRPRPVTEVLVVEEES
LTAV
Download sequence
Identical sequences E9I1L2
jgi|Dappu1|230004|estExt_fgenesh1_pg.C_15190001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]