SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9I237 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9I237
Domain Number 1 Region: 209-338
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000021
Family C-type lectin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9I237
Sequence length 395
Comment (tr|E9I237|E9I237_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX61943.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_120732 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MEEAKKKTCFCVLAGAIVTLLLIATVSLLVALALPRMLNDGEYGDIPDYQTDEVYALLHV
PHLIFNAARMKDVVTLTPENVSDNVPTLATDTSMTVKPKLTNSAVKPSDVTDLIPRLNEF
YLTLPDVGDTFDASIINLPEKSDEVTEPLAPTTENEDKEIISDQTVSPPPVVTNSVSTVT
LVTLPDFVFPESIKRPNRPAVVAEKVSSQHSYDFFMENVNFATSVEICRQINQGSRLISI
ESSYEKRIVDNYVRSHQLDIFGYKEDYLRYVWTGGYFDLDSNQPYALRWVDHPTPMEAFE
YQPFCPESKDIHSIIDLALSELKTQTFGLTNLSPCNRRWAHVVIDFTGRRIGGSCWQVYV
RDVVSPDGLRLPFICKRFENSLPDLTQIFTTGKRW
Download sequence
Identical sequences E9I237
jgi|Dappu1|120732|fgenesh1_pg.C_scaffold_1766000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]