SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9I3Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9I3Y6
Domain Number 1 Region: 39-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000018
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9I3Y6
Sequence length 77
Comment (tr|E9I3Y6|E9I3Y6_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX61294.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_340225 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
AATKQNEIIPGCANSESEETSSNLKKDNAQKMNTLKTSVLTSYDPCKDHRCRKGQCVSKK
NGKNYSCKCQARWGGKY
Download sequence
Identical sequences E9I3Y6
jgi|Dappu1|340225|NCBI_GNO_405500001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]