SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9PH99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9PH99
Domain Number - Region: 363-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000596
Family HkH motif-containing C2H2 finger 0.07
Further Details:      
 
Domain Number - Region: 305-330,527-543
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00544
Family Cytochrome c3-like 0.073
Further Details:      
 
Domain Number - Region: 207-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00834
Family Classic zinc finger, C2H2 0.077
Further Details:      
 
Domain Number - Region: 636-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0532
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number - Region: 752-808
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0992
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9PH99
Sequence length 1041
Comment (tr|E9PH99|E9PH99_HUMAN) E3 SUMO-protein ligase ZNF451 {ECO:0000313|Ensembl:ENSP00000421645} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF451 OC=Catarrhini; Hominidae; Homo.
Sequence
MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPLRPVLEYIDLVSSDDEEPSTSY
TDENIKRKDHIDYQKDKVALTLARLARHVEVEKQQKEEKNRAFREKIDFQHAHGLQELEF
IRGHSDTEAARLCVDQWLKMPGLKTGTINCGTKSSFRRGGHTWVSGKPILCPIMHCNKEF
DNGHLLLGHLKRFDHSPCDPTITLHGPFFSSFACVVCYKKFVTQQQYRDHLFDKEATDDG
HNNNLLPQIIQCFACPNCFLLFSRKEECSKHMSGKNHFHQSFKLGDNKGIAHPISFPSFA
KKLLISLCKDVPFQVKCVACHKTLRSHMELTAHFRVHCRNAGPVAVAEKSITQVAEKFIL
RGYCPDCNQVFVDETSTQNHKQNSGHKVRVINSVEESVLLYCHSSEGNKDPSSDLHLLLD
QSKFSSLKRTMSIKESSSLECIAIPKKKMNLKDKSHEGVACVQKEKSVVKTWFCECNQRF
PSEDAVEKHVFSANTMGYKCVVCGKVCDDSGVIRLHMSRIHGGAHLNNFLFWCRTCKKEL
TRKDTIMAHVTEFHNGHRYFYEMDEVEGETLPSSSTTLDNLTANKPSSAITVIDHSPANS
SPRGKWQCRICEDMFDSQEYVKQHCMSLASHKFHRYSCAHCRKPFHKIETLYRHCQDEHD
NEIKIKYFCGLCDLIFNVEEAFLSHYEEHHSIDYVFVSEKTETSIKTEDDFPVIETSNQL
TCGCRESYICKVNRKEDYSRCLQIMLDKGKLWFRCSLCSATAQNLTDMNTHIHQVHKEKS
DEEEQQYVIKCGTCTKAFHDPESAQQHFHRKHCFLQKPSVAHFGSEKSNLYKFTASASHT
ERKLKQAINYSKSLDMEKGVENDLSYQNIEEEIVELPDLDYLRTMTHIVFVDFDNWSNFF
GHLPGHLNQGTFIWGFQGGNTNWKPPLNCKIYNYLNRIGCFFLHPRCSKRKDAADFAICM
HAGRLDEQLPKQIPFTILSGDQGFLELENQFKKTQRPAHILNPHHLEGDMMCALLNSISD
TTKGTQLQSQCKPPKRRRLHC
Download sequence
Identical sequences E9PH99
ENSP00000421645 ENSP00000421645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]