SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9PIP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9PIP6
Domain Number 1 Region: 315-764
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.31e-121
Family PIWI domain 0.00075
Further Details:      
 
Domain Number 2 Region: 17-337
Classification Level Classification E-value
Superfamily PAZ domain 2.35e-74
Family PAZ domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9PIP6
Sequence length 764
Comment (tr|E9PIP6|E9PIP6_HUMAN) Piwi-like protein 3 {ECO:0000313|Ensembl:ENSP00000435718} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PIWIL3 OC=Catarrhini; Hominidae; Homo.
Sequence
MKHVKDSKTGSEGTVVQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRTILLDQHRRK
FGERHIFDGNSLLLSRPLKERRVEWLSTTKDKNIVKITVEFSKELTPTSPDCLRYYNILF
RRTFKLLDFEQVGRNYYTKKKAIQLYRHGTSLEIWLGYVTSVLQYENSITLCADVSHKLL
RIETAYDFIKRTSAQAQTGNIREEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNK
SDGSKITYIDYYRQQHKEIVTVKKQPLLVSQGRWKKGLTGTQREPILLIPQLCHMTGLTD
EICKDYSIVKELAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPG
RVLKNANIVQGRRMVKANSQGDWSREIRELPLLNAMPLHSWLILYSRSSHREAMSLKGHL
QSVTAPMGITMKPAEMIEVDGDANSYIDTLRKYTRPTLQMVICILPNDDKRRYDSIKRYL
CTKCPIPSQCVVKKTLEKVQARTIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHD
IVNRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHS
VIVYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNFTLAFIVVKKRINTRFFLKHGSNFQ
NPPPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDTIGLSPDTVQRLTYCLCH
MYYNLPGIIRVPAPCHYAHKLAYLVGQSIHQEPNRSLSTRLFYL
Download sequence
Identical sequences E9PIP6
ENSP00000431843 ENSP00000435718 ENSP00000431843 ENSP00000435718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]