SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9PLG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9PLG6
Domain Number 1 Region: 57-186
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.23e-27
Family Toll/Interleukin receptor TIR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9PLG6
Sequence length 189
Comment (tr|E9PLG6|E9PLG6_HUMAN) Single Ig IL-1-related receptor {ECO:0000313|Ensembl:ENSP00000435135} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SIGIRR OC=Catarrhini; Hominidae; Homo.
Sequence
MGPSPAPSRTSASPPSLFRELALQATWLRCWPPSWSCWPCCWPPCSMSSAVSTCCSDGKL
YDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRL
IVVLSDAFLSRAWCSHSFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHRHLVT
LLLWRPGSV
Download sequence
Identical sequences E9PLG6
ENSP00000435135 ENSP00000435135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]