SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9PRY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9PRY9
Domain Number - Region: 6-36
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.000175
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9PRY9
Sequence length 37
Comment (tr|E9PRY9|E9PRY9_HUMAN) Ribonucleoside-diphosphate reductase large subunit {ECO:0000313|Ensembl:ENSP00000434069} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RRM1 OC=Catarrhini; Hominidae; Homo.
Sequence
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPM
Download sequence
Identical sequences A0A2J8ITU7 A0A2J8R1W3 E9PRY9
ENSP00000434069 ENSP00000434069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]