SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9PUD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9PUD7
Domain Number 1 Region: 43-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000149
Family SMI1/KNR4-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9PUD7
Sequence length 241
Comment (tr|E9PUD7|E9PUD7_MOUSE) Tubulin polyglutamylase complex subunit 2 {ECO:0000313|Ensembl:ENSMUSP00000122538} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=5730494M16Rik OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEETTPPLQAGSKPHLEKLTLGVTRILESSPGVTEVSIIEKLPAERHMISSWEQKNNCVM
PEDVRNFYLMTNGFHMTWSVKLDEHIIPLGSMVINGISKLTQLIQSSVYSLPNAPTLADL
EDDTQEGNEDHQLEKPHFDCRSAIFELDSCNGNGKVCLVYKNGKPGLAHDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKVASIYSQEESMNFQATSVRNQ
W
Download sequence
Identical sequences E9PUD7
ENSMUSP00000122538 NP_001136170.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]