SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9PWL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9PWL0
Domain Number 1 Region: 296-495
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-36
Family SPRY domain 0.00047
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily RING/U-box 5.5e-26
Family RING finger domain, C3HC4 0.0055
Further Details:      
 
Domain Number 3 Region: 88-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.11e-17
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  E9PWL0
Domain Number - Region: 120-259
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00144
Family Apolipoprotein A-I 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9PWL0
Sequence length 497
Comment (tr|E9PWL0|E9PWL0_MOUSE) Tripartite motif-containing 30D {ECO:0000313|Ensembl:ENSMUSP00000033211} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Trim30d OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASSVLEMIKEEVTCPICLELLKESVSADCNHSFCRACITLHYESNRNPEGEGNCPVCRV
PYLFENLRPNRHVANIVERLKGFKSIPEEEQKVNACVEHGEKLQLFCKEDMMAICWLCKQ
SQEHSGHQTALIEEVNHEYKEKLQAALQKLMENEKRCDEWQDDLQQQRADWENQIHSDIE
DIQIEFNGLRDLLDSKENEKLQELKKEKEEVMEKLEESEHELREQRELVRDLISYVQHQL
ELSVMEMKQGVNYVLTSIQTMTLKQPQIVPPKRRRGTSKAPHLKGMLQSFEGLMDVQQYW
VHMTLHARNNAVIAINKEKRQIQYRSYNTVPVSEIYHLGVLGYPALSSGKHYWEVDISRS
DAWLLGLNDGKCAQPQLHSKEEMGIKKKYHSHIKQNVTFQPKCGYWVIGMKNSSVYNAFD
ECSITHNSSVLALSLPDRPSRVGVFLDQEVCTLSFYDVSNSGALIYRFYDPSFPVEVYPY
FNPMECSEPMTVCGPPS
Download sequence
Identical sequences E9PWL0
ENSMUSP00000065020 NP_954597.2.92730 ENSMUSP00000033211 10090.ENSMUSP00000102434 ENSMUSP00000033211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]