SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9PYV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9PYV1
Domain Number 1 Region: 488-773
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-63
Family Nuclear receptor ligand-binding domain 0.0000000019
Further Details:      
 
Domain Number 2 Region: 434-517
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.24e-25
Family Nuclear receptor 0.0000132
Further Details:      
 
Weak hits

Sequence:  E9PYV1
Domain Number - Region: 74-109
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00392
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9PYV1
Sequence length 793
Comment (tr|E9PYV1|E9PYV1_MOUSE) Glucocorticoid receptor {ECO:0000313|Ensembl:ENSMUSP00000095199} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Nr3c1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSASSPSVAAASQADSKQQ
RILLDFSKGSASNAQQQQQQQQQQQQQQQQQPQPDLSKAVSLSMGLYMGETETKVMGNDL
GYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEKEFPQTHSD
PSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPWRSDLLIDEN
LLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVALPQVKTEKDDF
IELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQ
QQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSNGYSSPGMRPDVS
SPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDC
IIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENANKTIVPAA
LPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGF
RNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLIINEQRMTLPCMYDQCK
HMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKR
EGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKY
SNGNIKKLLFHQK
Download sequence
Identical sequences E9PYV1
XP_006525721.1.92730 XP_006525722.1.92730 XP_006525723.1.92730 XP_006525724.1.92730 XP_006525725.1.92730 XP_006525726.1.92730 XP_006525727.1.92730 XP_006525728.1.92730 ENSMUSP00000095199 10090.ENSMUSP00000095199 ENSMUSP00000095199 ENSMUSP00000095199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]