SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9PZ57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9PZ57
Domain Number - Region: 2-50
Classification Level Classification E-value
Superfamily SIS domain 0.02
Family mono-SIS domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9PZ57
Sequence length 62
Comment (tr|E9PZ57|E9PZ57_MOUSE) R3H domain-containing protein 2 {ECO:0000313|Ensembl:ENSMUSP00000131255} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=R3hdm2 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEDVEKEGEENGLRQETQRRTSS
HG
Download sequence
Identical sequences E9PZ57
ENSMUSP00000131255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]