SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9Q223 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9Q223
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Globin-like 6.87e-37
Family Globins 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9Q223
Sequence length 103
Comment (tr|E9Q223|E9Q223_MOUSE) Hemoglobin, beta adult s chain {ECO:0000313|Ensembl:ENSMUSP00000115607} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Hbb-bs OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK
VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPEN
Download sequence
Identical sequences E9Q223
ENSMUSP00000115607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]