SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9Q263 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9Q263
Domain Number 1 Region: 601-741
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-32
Family Synaptotagmin-like (S variant) 0.047
Further Details:      
 
Domain Number 2 Region: 3-147
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.96e-27
Family PLC-like (P variant) 0.000000976
Further Details:      
 
Domain Number 3 Region: 1437-1567
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.25e-23
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 
Domain Number 4 Region: 468-527
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000464
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9Q263
Sequence length 1609
Comment (tr|E9Q263|E9Q263_MOUSE) Protein unc-13 homolog B {ECO:0000313|Ensembl:ENSMUSP00000103587} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Unc13b OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTKNPTPHK
ILLDTRFELPFDIPEEEARYWTYKLEQINALADDNEYSSQEESQRKPLPTAAAQCSFEDP
DSAVDDRDSDYRSETSNSAPPPYHTTTQPNASVHQFPVPVRLPQQLFLQGSSHDSCNDSM
QSYDLDYPERRALSPTSSSRYGSSCNVSQGSSLLSELDQYHEQDDDGRERDSIHSSHSYG
SLSKDGQAGLGEQEKALEVTCESEKEKTGESKEMRDDATIHPPSDLVLHKDHVLGPQESL
PEETASSPFTQARAHWFRAVTKVRLQLQEISDDGDPSLPQWLPEGPAGGLYGIDSMPDLR
RKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNF
EVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSSKHGA
EDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVKQSVLDGTSKWSA
KITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSD
RIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSG
AIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVWIPEARGDDAWKVYFDE
TAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTN
VSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSI
TFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQLQEQPLEEPGPS
IRNLDFWPKLITLIVSIIEEDKNSYTPVLSQFPQELNVGKVSAEVMWHLFAQDMKYALEE
HEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPAWFEQFVLQWLDENEDVSL
EFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPNILAHYMRRF
AKTIGKVLMQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFEAMGGKELDSEAA
DSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGNASPNARASVAQD
ADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIVLPPLTDQTGTQL
ILTAAKELSQLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKS
PDLQSLRYALSLYTQTTDTLIKTFVRSQTAQVHDGKGIRFTANEDIRPEKGAGVDDPVGE
VSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKS
KSNNWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSC
ACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRSTEEGS
Download sequence
Identical sequences E9Q263
ENSMUSP00000103587 ENSMUSP00000103587 ENSMUSP00000128608 XP_006537858.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]