SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9Q4X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9Q4X5
Domain Number 1 Region: 93-219
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-44
Family Phosphotyrosine-binding domain (PTB) 0.000000361
Further Details:      
 
Domain Number 2 Region: 541-619
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000116
Family SH3-domain 0.00034
Further Details:      
 
Weak hits

Sequence:  E9Q4X5
Domain Number - Region: 693-747
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00408
Family SAM (sterile alpha motif) domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9Q4X5
Sequence length 777
Comment (tr|E9Q4X5|E9Q4X5_MOUSE) Epidermal growth factor receptor kinase substrate 8-like protein 1 {ECO:0000313|Ensembl:ENSMUSP00000133206} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Eps8l1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MQKRKIPPPELQRARADTGWGIISFAGGPAWLNEQAWGWKDFFRERVLRHLQVDRAPHLA
TMSTTTGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYHVNHLVTFCLGEEDGVHTVEDAS
RKLAVMDSQGRVWAQEMLLRVSPSQVTLLDPVSKEELESYPLDAIVRCDAVMPRGRSRSL
LLLVCQEPERAQPDVHFFQGLLLGAELIREDIQGALQNYRSGRGERRAAALRATQEELRR
GASPAAETPPLQRRPSVRLVINTVEPSAVRGRPQVESIPETEEARKPDQARTTSSADPTS
PDLGPRGPELAGLQAERDVDILNHVFDDVESFVSRLQKSAEATRVLEHRERGRRTRRRAA
GEGLLTLRAKPPTEAEYTDVLQKIKYAFSLLARLRGNIANPSSPELLHFLFGPLQMIVNT
SGGPEFAKSVRRPHLTLEAVTLLRDNVTPGENELWTSLGDSWTCPGVELPPEEGSPYSPE
FYNGWEPPATDPQGRPWEDPVEKQLQHEKRRRQQSAPQVAVNGQQDPELETESQLEEKAR
KWVLCNYDFQARNGSELSVKHRDVLEVLDDRRKWWKVRDHQGQEGYVPYNILTPHPGPQV
HRSQSPARHLETSTPPPPPAPAPAPTQVRPQWDSCDSLNSLDPSEKEKFSQMLCVNEELQ
SRLAQGRSGPSRVTPGPRAQEPQLSPRSEASVVRAWLQTKGFSSGTVEALGVLTGAQLFS
LQKEELRAVCPEEGARVYSQVTVQRALLEDREKVSELEAVMEKQKKKVEGETKTEVI
Download sequence
Identical sequences E9Q4X5
ENSMUSP00000133102 ENSMUSP00000133206 ENSMUSP00000133206 XP_006540386.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]