SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9QEU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9QEU7
Domain Number 1 Region: 494-583
Classification Level Classification E-value
Superfamily YccV-like 1.44e-25
Family YccV-like 0.0062
Further Details:      
 
Domain Number 2 Region: 25-100
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000262
Family F-box domain 0.0066
Further Details:      
 
Weak hits

Sequence:  E9QEU7
Domain Number - Region: 403-463
Classification Level Classification E-value
Superfamily TPR-like 0.00474
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9QEU7
Sequence length 611
Comment (tr|E9QEU7|E9QEU7_DANRE) F-box protein 21 {ECO:0000313|Ensembl:ENSDARP00000102614} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=fbxo21 OC=Cyprinidae; Danio.
Sequence
MATPYTGDRVLGTNVVTSGRFSKQLIDLPAEILEHILCFPVLNPVDICNVSSTCKRLHDV
CHGRGKVWAHQYKLRWPRLQRFYRQNESYDWLKEFKTRHTVGQQIRRTVESISKRFFTEV
PCIGQVLGDSFAEIESLGAPEHFCEDELLGILNSDKRKSLTLKYYAKKILYFFRQQNILR
NLKVFLERPPEQQSALEGAVLVDQYCNPLTDVTFESISAQVEEITDKVKKCLRAQNAAHP
SLRAGQGECFVLEDFEFQRQVICAVNAVLYEQLQYKGNERDYYNPLNSYIHQVLLRRTGI
PISLSVLYMTLARKLGVPLEPVNFPNHFLLRWCQNQRRCGDIYDYIYIDAFGNGKQLAAK
ECEILIKHQATADYYSAISTSELLLRMVGNLLNIGMRGEGNEKSYQLLRDSLDLYLSINP
DNVQYLLLQARLYFHLGIWPEKVLDILQHIQALDPSQHGAVGYLVQHTLEHIQHKRHPVE
PEVKRRSAPEHRDVQFSTGLIMKHKRSGYNCVIYGWDPKCTMSQEWINTMRVHQLSKGAD
QPFYNVLVQDGTCRYAAQENLEPHSAPLEIAHPEIGRYFNEYSETHYISNEELQARYPED
MCKTNRTVEEL
Download sequence
Identical sequences E9QEU7
ENSDARP00000102614 ENSDARP00000102614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]