SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9QGC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9QGC4
Domain Number 1 Region: 4-38
Classification Level Classification E-value
Superfamily WW domain 0.00000000000264
Family WW domain 0.0013
Further Details:      
 
Domain Number 2 Region: 658-785
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000194
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 
Domain Number 3 Region: 53-88
Classification Level Classification E-value
Superfamily WW domain 0.0000000012
Family WW domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9QGC4
Sequence length 1129
Comment (tr|E9QGC4|E9QGC4_DANRE) WW and C2 domain-containing 1 {ECO:0000313|Ensembl:ENSDARP00000113286} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=wwc1 OC=Cyprinidae; Danio.
Sequence
MPRKELPLPEGWEEARDFDGKVYYIDHINQTTSWIDPRDRQTKPLTFADCIGDELPVGWE
EAYDPHVGAYYVDHNTKSTQLEDPRAQWQREQELMLHDYLNVVQEALSAQKEIYQVKEQR
LRLAQQEYRQLNDAWRDKSSSQTSLNSRSSSSSKYDPEILKAEIVTAKSRVNKLKRDLAY
MKQELHYKEQGFETLKEIDHKVSSASHGYKLHEAQAILKEVKSIKDAISSGEKEKQELMR
KLAVLKDGFQLDYGSQSDLWASNPSLANSNLSLPRLYSDAESQTDIPAQFVSSSNKLAEK
VRLSLKYEEAKRRIANIEVQIAKLDSEAWPGLLDPERDRLILINEKEELLKELQYVRPCK
RAPNEAEKIESEKKRLEKDLQAARDNQSKALTERLRLHYRRNKLVKELEETVRVASSLHT
QLKSSRGSLTSSRGSLANSSLGSTSSLSFTDVYLEQPELGDPDFQNKLDSILQEGSTSGY
RPSSSITTIHENEVSSSSVQIGGGPGVGQRTQVLRLSETPHSMNSLSPRSSLSSLSPPCS
PLVTEASFLSGEVFSGPASQLDLDLQTRLMELRLEEDQQQGQLNYQDNKQESIMAVESSK
DAVTQTRGSGPGSKKAGVTSAVSDESVAGDSGVYEPSEKRPGLPVEQLLAFDDGSSASSA
QIKLGLKYEVKEKRFTVFVMQLSNYSALSLPANQNIYVRVVVLPCSETVRCLFRTHCALP
QEPVELKEAFSLQVSSTALRQKTLRIDVCTTSKSGREHCLAGAQISLADEEYSEEWCTKW
YNLLNCTYMPEMDGKQKETEMPALQELTPASSENAASCMENVPLEDWPAETLEGDVFVDE
EGSDGEEGEEFYPDDCQWEQEEEPLKAGPTTVIAEKVNKETSMDGLPHSTSVVRPKERRH
DVHQQNPFMRGNTIIRSKTFSPGPQSQYICRINRSDSDSSTLSKKSPFVRNASERRSVRM
KKPPMQVKGLDGLLRTSLDLELDLQVTRTRHSRLTEELRVLRELKEQMEKARQQGQHVLP
TWVQEDERFCLLLKHAERQTQEEQLQEKRVEKMMRAAAKDVHKIRGQSLKEVPGVQSFRE
DGLLHQSEDKRSRPTSGRCVEDNPSLCLIWRRKLTSGGIMKNGVTGKCM
Download sequence
Identical sequences E9QGC4
ENSDARP00000113286 ENSDARP00000113286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]