SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9QPT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9QPT8
Domain Number 1 Region: 270-462
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.5e-63
Family Hemopexin-like domain 0.000000325
Further Details:      
 
Domain Number 2 Region: 102-261
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.95e-51
Family Matrix metalloproteases, catalytic domain 0.00000465
Further Details:      
 
Domain Number 3 Region: 19-94
Classification Level Classification E-value
Superfamily PGBD-like 1.29e-19
Family MMP N-terminal domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9QPT8
Sequence length 463
Comment (tr|E9QPT8|E9QPT8_MOUSE) Matrix metalloproteinase {ECO:0000256|RuleBase:RU364080} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Mmp1a OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MPSLPLLLLLWAASSYSFPVFHNGDRQNVETVWKYLENYYNLGKNMQAKNVNGKEMMAEK
LRQMQQLFGLKVTGNSDPETLRAMKKPRCGVPDVAPYAITHNNPRTKTHLTYSILNYTPY
LPKAVVEDAIARAFRVWSDVTPLTFQRVFEEEGDIVLSFHRGDHGDNNPFDGPNYKLAHT
FQPGPGLGGDVHYDLDETWTNSSENFNLFYVTAHELGHSLGLTHSSDIGALMFPSYTWYT
EDFVLNQDDINRIQDLYGPSPNPIQPTGATTPHPCNGDLTFDAITTFRGEVFFFKGRFYI
RVNRFMPEPELNLIGILWPNLPVKLDAAYEASMIDQVRYFKGSKVWAVQEQSVLRGFPRD
IHSFFGFPSNVTHIDAAVCEEETGKTYFFVDHMYWRYDENTQSMDPGYPRLTAEDFPGID
DKVDDVFQKGENFYFFHQSVQHRFNLQIRRVDDSRDSSTWFNC
Download sequence
Identical sequences E9QPT8
ENSMUSP00000034492 ENSMUSP00000034492 10090.ENSMUSP00000034492 ENSMUSP00000034492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]