SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0LIJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0LIJ6
Domain Number 1 Region: 85-211
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.4e-34
Family AlaX-like 0.000000639
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Translation proteins 1.38e-21
Family AlaX-M N-terminal domain-like 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0LIJ6
Sequence length 214
Comment (tr|F0LIJ6|F0LIJ6_THEBM) Alanyl-tRNA synthetase domain protein {ECO:0000313|EMBL:ADT83270.1} KW=Complete proteome OX=391623 OS=Thermococcus barophilus (strain DSM 11836 / MP). GN=TERMP_00293 OC=Thermococcus.
Sequence
MTKKLYYEDAYLKEAKAKVVEIKDNALLLDQTIFYPTGGGQPHDRGTINGVHVLDVYKDE
EGNVWHVVEEPEKFRIGDEVELKIDWDYRYKLMRIHTAMHLLDHVLNEVLGKDKWQLYGS
GMSVEKGRYDILYPENVNKYKEQIIERFNKYVDEGGEVKIWWEGEKRLTQIRDFEVLPCG
GTHVKDIREIGHIKKLKRSSIGKGKQRLEIWLED
Download sequence
Identical sequences F0LIJ6
WP_013466568.1.91259 gi|315230057|ref|YP_004070493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]