SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0NBB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0NBB8
Domain Number 1 Region: 78-162
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.02e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F0NBB8
Sequence length 189
Comment (tr|F0NBB8|F0NBB8_SULIR) KH type 1 domain protein {ECO:0000313|EMBL:ADX84265.1} KW=Complete proteome OX=930945 OS=Sulfolobus islandicus (strain REY15A). GN=SiRe_0170 OC=Sulfolobus.
Sequence
MRILFTTVEDEKLEVVKKIIEKLEQFTDTKIMYDERTKTFNILPKGQNQYEALKAVSVIR
AIGLGFDEQSAFRLLSDEYILDVIDLKTLIGSNPDAIRRVKGRIIGEGGKAKRIIQEYTG
VDISIYGHYIGIIGPYDQVQIARKAIELLIDGKEHSSVYKFLDKAEKDLIIYKTSKLGRK
GINEIKSNR
Download sequence
Identical sequences C4KK82 F0NBB8
WP_012735411.1.100559 WP_012735411.1.27011 WP_012735411.1.67233 WP_012735411.1.89621 WP_012735411.1.90709 WP_012735411.1.91160 WP_012735411.1.97021 gi|238618666|ref|YP_002913491.1| 426118.M164_0189 gi|385774911|ref|YP_005647479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]