SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0NRK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0NRK2
Domain Number 1 Region: 58-131
Classification Level Classification E-value
Superfamily PUA domain-like 4.97e-23
Family PUA domain 0.001
Further Details:      
 
Domain Number 2 Region: 7-55
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0000418
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F0NRK2
Sequence length 135
Comment (tr|F0NRK2|F0NRK2_SULIH) PUA domain containing protein {ECO:0000313|EMBL:ADX83153.1} KW=Complete proteome OX=930943 OS=Sulfolobus islandicus (strain HVE10/4). GN=SiH_1805 OC=Sulfolobus.
Sequence
MFPEDKHFLIQRSINTKKIRNVLTSGGELYLVLRAQDVLFSLTLLSGSVIKGCSKFPEYR
VVIPKNLEEFIKNGRNVFSKHVIAVDKRIRAGDEVIVVNENDELIAIGKAKLSGEEMMEY
KRGMAVHVKRGVLDE
Download sequence
Identical sequences C3MY46 C3MZI5 C4KIR5 F0NRK2
gi|385773800|ref|YP_005646367.1| gi|229585360|ref|YP_002843862.1| WP_012711833.1.27011 WP_012711833.1.97021 gi|227828121|ref|YP_002829901.1| gi|238620321|ref|YP_002915147.1| 426118.M164_1876 427317.M1425_1859 427318.M1627_1946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]